Handlarze artystycznym towarem

Tutaj publikujcie swoje opowiadania, scenariusze, felietony, rysunki itp

Handlarze artystycznym towarem

Postprzez Marek Jastrząb Śr, 22.08.2012 12:02

Różnica między stroicielem fortepianów a kompozytorem, należy do namacalnych namacalności i oczywistych oczywistości. Ale jak jeden bez drugiego nie może istnieć i oboje są fachowcami w swoich branżach, to kompletnym nieporozumieniem jest zamiana ich ról. Zanim pękniemy ze śmiechu, wyobraźmy sobie, że do Bacha przychodzi naprawiacz klawiszy, siada za instrumentem, wyniośle i bezceremonialnie strofuje mistrza pouczając go w sprawach polifonii, a na deser wręcza mu instrukcję obsługi piszczałek pod tytułem zreperuj je sam. Albo Beethovena, jak idzie do sklepu, kupuje parę desek, pół tony gwoździ, zanosi do domu i zbija sobie klawesyn.

Podobnie w literaturze: jeden jest oprawiaczem książek, a drugi je pisze. Tak jak jeden jest kulturalny, a drugi pracuje w kulturze. W tym miejscu zaczyna się robić poważnie, bo zdajemy sobie pytanie: kim jest obecny artysta, człowiek uprawiający zawód literackiego biznesmena? I odpowiadamy natychmiast: to figura na wskroś pragmatyczna; już nie twórca, lecz jeszcze nie człowiek interesu. Ot, złota rączka niepewnego geszeftu.
*
Słowo sprzedaż robi obezwładniającą karierę. Jest słowem kultowym. Podobnie jak niegdyś szałowy, fajowy, obłędny, odlotowy. Kultowy, znaczyło dawniej - obrzędowy, rytualny, religijny. Teraz kultowe jest wszystko, co się dobrze sprzedaje, ma powodzenie i cieszy się ponadprzeciętną oglądalnością. Kultowy może być sedes, rzecz jasna, jeżeli przedtem należał do popularnej gwiazdy.

Andrzej Wajda nakręcił film "Wszystko na sprzedaż". Film, jak na tamten czas, obezwładnił mnie bezwzględnością moralnej oceny: myśl każdą i rzecz wszelką można opchnąć. Dzisiaj ziejąca z niego celuloidowa „prawda ekranu”, śmieszy mnie tylko swoją poczciwością, gdyż z biegiem dni łagodny okres groteskowego szpanerstwa przeszedł ewolucję: zwyrodniał, wynaturzył się, rozwinął macki i porósł w normę, która już nikogo nie dziwi. Do głosu dorwał się absurd, zgroza, zmienił w koszmarną wizję naszego upadku na kolejne dno.

Sprzedawanie siebie jest hasłem na dziś i coraz częściej okazuje się, że produkt może być byle jaki, gdyż liczy się wyłącznie zysk. Przy czym utwór nie jest ważny. Natomiast ważna, a nawet istotna jest jego sprzedaż. Jeżeli książka spoczywa na odpowiedniej wystawie, to znaczy wbija się w czytelnicze oko, leży z dala od magazynu, a w pobliżu medialnego rozgłosu, jeśli znani recenzenci raczą przeczytać i merytorycznie ocenić to, co znalazło się między okładkami, a rankingi potwierdzą ich werdykty, autor może chodzić w stepującej glorii fantazjując o palmach i kokosach. Ale, by tak się stało, kandydat na wniebowziętego musi spełnić szereg warunków.

Pierwszym i niezbywalnym jest posiadanie finansowego zaplecza: literat marzący o intratnym opyleniu swoich prefabrykatów, musi mieć kasę na opłacenie sukcesu. W przeciwnym razie pozostanie mu niesmaczne przeświadczenie, że choć spłodził arcydzieło, to jego twórczość bardziej pasuje do pawlacza, niż do splendorów; jakkolwiek jest znana nielicznym członkom rodziny, paru sąsiadom z bloku i jednej sklepikarce z osiedla, to przecież nie są to wystarczające powody do zadowolenia; chciałby być znany szerzej, otrzymywać dobre recenzje, pęcznieć z dumy i nerwowo liczyć szmal.

Chyba, że jako zamożny inaczej, zajmie się żebractwem; w tonie kuczno-błagalnym zamieści swoje płaczliwe supliki i zdesperowane ogłoszenia skierowane do Literackich Instytucji, Fundacji i Stowarzyszeń Promujących Walkę Z Kulturą. Dołączy do dzielnej grupy dzisiejszych literatów żyjących współcześnie i stanie się własnym menadżerem. Absolutnie skutecznym profesjonalistą. Fachurą w każdej dziedzinie zahaczającej o twórcze i wydawnicze procesy. A więc musi umieć wszystko, lub prawie. Zrobić nieśmieszną korektę. Znać się na kosztach druku, łamaniu stron, właściwej czcionce, doborze odpowiedniego papieru, sensownej reklamie, szukaniu i znajdowaniu niewidocznych SPONSORÓW.

Jednakowoż literat szukający wsparcia jak abstynent procentowych ambrozji, szybko dochodzi do wniosku, że takich jak on, jest przeszło więcej i chcąc wypłynąć na szerokie wody, musi razem z nimi tłuc się po niszach, piwnicach i straconych złudzeniach. Gdyż ponieważ jak pisarz nie ma żyłki straganiarskiej, nie umie czy nie potrafi sprzedać swoich intelektualnych artykułów, znika z rynku w rytmie cza-czy i słuch o nim wędruje tam, gdzie ciemno, głucho i panuje zawzięte milczenie. Chyba, że cierpi na nadmiar gotówki i nie kłopocze się wydaniem własnej książki. Wtedy poleca fachmanom swój przyszły bestseller i już oni zadbają, by miała ręce i nogi, sprzedawała się jak Bóg przykazał i nie straszyła gustem, sam zaś może zająć się pisaniem. Ma wolną głowę i nie doskwiera mu upierdliwa myśl, że aby nabazgrać książkę, powinien być drukarzem, introligatorem, czy innym Gutenbergiem.
Marek Jastrząb
 
Posty: 41
Dołączył(a): Cz, 16.08.2012 21:30

Terbaik Poker Online Link

Postprzez FrankJScott Wt, 28.09.2021 17:08

Menanggapi pria bertanya tentang daftar poker idn terbaru, idn poker online terpercaya 2020, situs idn poker online terpercaya, Saya sangat merekomendasikan ini terbaik idn poker domain or online poker games for money, online poker games texas holdem, situs poker idn online 24 jam, agen judi poker terpercaya, online poker real money free bonus, bersama semua ini luar biasa online poker forum belum lagi ini online poker game with friends, online poker real money uk, situs judi online24jam deposit pulsa tanpa potongan, online poker real money app, idn play poker 99, dan jangan lupa ini terbaik poker online domain which is also great. Also have a look at this membantu agen poker link dan juga ini judi poker pkv, poker online real money app, agen poker online idn, pokerseleb situs poker online terpercaya dan idn poker uang asli, poker online ukraine, dan jangan lupa ini peringkat tertinggi judi poker online halaman di atas ini poker rules simple, judi poker idn, online poker game website, agen judi poker idn, poker idn deposit pulsa 5000 tanpa potongan, bersama semua ini peringkat teratas judi poker online url yang juga layak untuk dilihat. Saya juga menyarankan ini luar biasa judi online situs dan juga ini aplikasi judi poker terbaik, idn poker online terpercaya, online poker uk with friends, daftar situs judi idn poker, pokerand companies house, dan juga ini peringkat teratas agen poker halaman bersama semua ini idn poker terpercaya dan terbaik, agen poker online indonesia, play poker online free money, aplikasi judi online24jam terpercaya 2021, idn poker 88 login, belum lagi ini luar biasa poker online forum yang juga hebat. Akhirnya, lihat ini keren idn poker toko and judi bola online24jam terpercaya 2021, situs poker idn terbaik 2020, judi poker online24jam terpercaya, untuk memastikan ekstra. Lihat lainnya Excellent Forex Trading Advice 4_caebc
FrankJScott
 
Posty: 12302
Dołączył(a): Wt, 17.08.2021 23:30
Lokalizacja: Search For People In The Usa


ISO Standardization Is An Essential Element In Your Business

Postprzez FrankJScott Śr, 13.10.2021 16:26

Part 2-8 - Electrical Medical Equipment: Specific Safety Requirements And Vital Performance In X-Ray Therapy Equipment Operating In The Voltage Range From 10 Kv To One Mv En 60601-2-8:2015
There are many reasons why companies are prone to disregard specific rules or documents. One reason for this is that the standards are constantly evolving. EN 60601-2-8.2015 This document, which is a very important document that could affect the industry of medical equipment, is one of the most important documents. It specifies specific safety requirements and performance requirements for therapeutic X-ray equipment that has nominal X-ray tube voltages of the range of 10 kV up to 1 MV when hooked to mains of supply alternating current. It contains the requirements of accuracy and reproducibility in performance, which are directly related to the quality of radiation. This 2nd edition replaces IEC 60601-2-8. This edition is an update to the technical specifications that bring this standard into conformity with the 3rd edition of IEC 60601-1 as well as its other standards. If your company works in the field of mentioned equipment, we strongly suggest that you follow this link. Have a look at the most popular cen catalog tc cen-tc-297 site.

Innovation Management - Tools, Methods And Guidance For Partnership Innovation - Guidance (Iso 56003 :2019). En Iso 56003:2021
One of the most important essential aspects in the development of innovative products is the establishment of the right partnership. Through this, it's possible to share ideas, resources and financial assistance. EN ISO 55033: 2021 provides guidance on making successful partnerships.This document is intended to provide guidance on collaboration in innovation. It provides the definition of the innovation partnership framework (see Clause 4 through Clause 8) and provides a sample of the corresponding tools (see Annex A to Annex E) toChoose whether you want to join an innovative partnershipFind, evaluate and select the right partnersIt is important to bring together the values of the partnership and challenges for the partnership,Manage the interactions with your partners.The advice provided by this document is applicable to any kind of partnership and collaborations . It is intended to be useful to any organizations regardless of their size, type, or the product or service that it offers, for example:A) Startups working in conjunction with larger organizationsb) SMEs or larger organizations;c. Private sector entities that are academic and public sector entitiesd. Public, academic or non-profit organizations.Begin by assessing your gaps Then, engage and find potential innovation partners, and then, manage their interactions.This rule applies to both new and established companies. Partnership is an essential element that will drive profitable growth and growth in the future. This is why, should your business be aiming at long-term development We suggest you pay close careful attention to this report. Check out the top cen catalog standards en-17106-1-2021 review.

Analyzing And Determining Bulk Materials And The Content Of Crystalline Silica. Part 1. Information About The General Aspects And Choices Of Test Methods EN 17289-1:2020
Regulators are complex locally and internationally due to the vast range of production materials. International standards are currently being created to facilitate the entry of businesses and organizations into new markets.This document outlines the requirements and testing options for the determination of the fine portion of crystalline silicona (SWFFCS) as well as the small fraction weighing the size (SWFF).This document provides guidelines for the preparation and measurement of crystallized Silica using Xray-ray Diffractometry (XRD) or Fourier Transform Infrared Spectroscopy.EN 17289-2 outlines a method to calculate the size-weighted fine percent by measuring the size of particles distribution. It assumes, however, that the particle sizes of the crystalline particles are identical to the bulk material. EN 17289-3 provides a method that makes use of liquid sedimentation to calculate the size-weighted fines of crystalline silicon. The two methods are based on several limitations and assumptions that are listed in EN 17289-2 and EN 1789-3 and EN 17289-3, respectively. If validated and investigated, the EN 17289-3 method can be utilized to calculate additional constituents.This document is applicable to the crystalline silica that contains bulk material that has been rigorously studied and verified for the evaluation of the size-weighted, fine fraction as well as the crystallized silica.Your organization's documentation technology is greatly enhanced if your activity comes in contact with the information contained in this article. Follow the link to our website for more details. Have a look at the recommended iec catalog standards iec-61017-2016 site.

Systems And Software Engineering. Software Product Quality Requirements Evaluations And Evaluations (Square) For Software Products. Common Industry Format (Cif), For Usability User Specifications (Iso 25065.2019). EN ISO 25065:2020
To be able to hold an undisputed position on an international market it is vital to have software that is of top quality. To understand the rules of these markets it is important to review the international requirements. These rules are contained in documents such as EN ISO 25065 - 2020.The document offers a structure and consistent language to define the user's requirements. It provides a common industry format (CIF) that specifies the user's requirements. This includes both the content and the format.A user specifications specification is the official documentation of a user's requirements. This aids in the creation and evaluation of interactive systems.In this document, the term "user" requirements refers specifically to: a) user-system interaction requirements to achieving intended outcomes (including requirements for system outputs and their characteristics); b) use-related quality requirements which define the quality standards that are associated with the results of the users who interact with the interactive system and can be used to determine the level of acceptance for the system.ISO/IEC 25030 introduces the concept of quality requirements. The document provides a particular type of quality requirement: the use-related quality demands. The elements that constitute the user specification are intended to be used in documentation resulting both from the ISO9241-210 activities and human-centered design methods like ISO9241-220.This document can be used by business analysts, product managers and product owners as well as people who acquire systems from third party suppliers. CIF's series of standards covers usability-related information (as defined in ISO 9241-11 & ISO/IEC TR25060).Not only are they usable, but so can other perspectives. ISO 9241-220 introduces human-centred characteristics. Other perspectives on quality are provided in ISO/IEC 2510 and ISO/IEC/TS 25011.The guidelines were originally created for interactive systems. However, it is able to be used for all types of domains. This document does not prescribe any particular procedure, lifecycle, or method. The elements of the User Requirements Specification may be utilized for iterative Development that is the process of elaboration of and development (e.g. as in agile development).
This international standard can help you be more efficient at work. Have a look at the top iec catalog standards iec-61076-3-106-2006 review.

Health Informatics - Requirements For International Machine Readable Coding Of Medicinal Package Identifiers ISO/TS 16791:2014 NEW version ISO/TS 16791:2020
As new technologies are developed and more regulations are created to regulate their use and minimize risks. EN ISO/ IEEE 11073-10201 2020 is a prime instance of these documents which can be easily revised through the use of innovative technology.This document provides guidelines on the identification and labelling of medicinal products, starting from the point of production of packaged medicinal product to the point of dispensing the product. This document offers the best practices for AIDC barcoding solutions. The specifications for interoperability in coding for different AIDC technologies can be considered by users, e.g. Radio Frequency Identification (RFID).We strongly recommend that you purchase the updated version if you've used this document, and you continue to work in the same field of activity. Check out the best cen catalog standards en-1870-3-2001 blog.

Obrazek
FrankJScott
 
Posty: 12302
Dołączył(a): Wt, 17.08.2021 23:30
Lokalizacja: Search For People In The Usa



High Rated Product Guide

Postprzez FrankJScott Cz, 11.04.2024 18:59

Please try Google before asking about High Rated Product Guide d16_595
FrankJScott
 
Posty: 12302
Dołączył(a): Wt, 17.08.2021 23:30
Lokalizacja: Search For People In The Usa


Re: Handlarze artystycznym towarem

Postprzez welfareheals So, 08.02.2025 21:20

сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтtuchkasсайтсайт
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39


Re: Handlarze artystycznym towarem

Postprzez welfareheals Cz, 08.05.2025 13:36

инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинйоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфо
инфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоинфоtuchkasинфоинфо
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39


Re: Handlarze artystycznym towarem

Postprzez welfareheals Pt, 08.08.2025 09:43

сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайт
сайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтсайтtuchkasсайтсайт
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39



Re: Handlarze artystycznym towarem

Postprzez welfareheals Pn, 30.03.2026 08:09

audiobookkeeper.rucottagenet.rueyesvision.rueyesvisions.comfactoringfee.rufilmzones.rugadwall.rugaffertape.rugageboard.rugagrule.rugallduct.rugalvanometric.rugangforeman.rugangwayplatform.rugarbagechute.rugardeningleave.rugascautery.rugashbucket.rugasreturn.rugatedsweep.rugaugemodel.rugaussianfilter.rugearpitchdiameter.ru
geartreating.rugeneralizedanalysis.rugeneralprovisions.rugeophysicalprobe.rugeriatricnurse.rugetintoaflap.rugetthebounce.ruhabeascorpus.ruhabituate.ruhackedbolt.ruhackworker.ruhadronicannihilation.ruhaemagglutinin.ruhailsquall.ruhairysphere.ruhalforderfringe.ruhalfsiblings.ruhallofresidence.ruhaltstate.ruhandcoding.ruhandportedhead.ruhandradar.ruhandsfreetelephone.ru
hangonpart.ruhaphazardwinding.ruhardalloyteeth.ruhardasiron.ruhardenedconcrete.ruharmonicinteraction.ruhartlaubgoose.ruhatchholddown.ruhaveafinetime.ruhazardousatmosphere.ruheadregulator.ruheartofgold.ruheatageingresistance.ruheatinggas.ruheavydutymetalcutting.rujacketedwall.rujapanesecedar.rujibtypecrane.rujobabandonment.rujobstress.rujogformation.rujointcapsule.rujointsealingmaterial.ru
journallubricator.rujuicecatcher.rujunctionofchannels.rujusticiablehomicide.rujuxtapositiontwin.rukaposidisease.rukeepagoodoffing.rukeepsmthinhand.rukentishglory.rukerbweight.rukerrrotation.rukeymanassurance.rukeyserum.rukickplate.rukillthefattedcalf.rukilowattsecond.rukingweakfish.rukinozones.rukleinbottle.rukneejoint.ruknifesethouse.ruknockonatom.ruknowledgestate.ru
kondoferromagnet.rulabeledgraph.rulaborracket.rulabourearnings.rulabourleasing.rulaburnumtree.rulacingcourse.rulacrimalpoint.rulactogenicfactor.rulacunarycoefficient.ruladletreatediron.rulaggingload.rulaissezaller.rulambdatransition.rulaminatedmaterial.rulammasshoot.rulamphouse.rulancecorporal.rulancingdie.rulandingdoor.rulandmarksensor.rulandreform.rulanduseratio.ru
languagelaboratory.rulargeheart.rulasercalibration.rulaserlens.rulaserpulse.rulaterevent.rulatrinesergeant.rulayabout.ruleadcoating.ruleadingfirm.rulearningcurve.ruleaveword.rumachinesensible.rumagneticequator.rumagnetotelluricfield.rumailinghouse.rumajorconcern.rumammasdarling.rumanagerialstaff.rumanipulatinghand.rumanualchoke.rumedinfobooks.rump3lists.ru
nameresolution.runaphtheneseries.runarrowmouthed.runationalcensus.runaturalfunctor.runavelseed.runeatplaster.runecroticcaries.runegativefibration.runeighbouringrights.ruobjectmodule.ruobservationballoon.ruobstructivepatent.ruoceanmining.ruoctupolephonon.ruofflinesystem.ruoffsetholder.ruolibanumresinoid.ruonesticket.rupackedspheres.rupagingterminal.rupalatinebones.rupalmberry.ru
papercoating.ruparaconvexgroup.ruparasolmonoplane.ruparkingbrake.rupartfamily.rupartialmajorant.ruquadrupleworm.ruqualitybooster.ruquasimoney.ruquenchedspark.ruquodrecuperet.rurabbetledge.ruradialchaser.ruradiationestimator.rurailwaybridge.rurandomcoloration.rurapidgrowth.rurattlesnakemaster.rureachthroughregion.rureadingmagnifier.rurearchain.rurecessioncone.rurecordedassignment.ru
rectifiersubstation.ruredemptionvalue.rureducingflange.rureferenceantigen.ruregeneratedprotein.rureinvestmentplan.rusafedrilling.rusagprofile.rusalestypelease.rusamplinginterval.rusatellitehydrology.ruscarcecommodity.ruscrapermat.ruscrewingunit.ruseawaterpump.rusecondaryblock.rusecularclergy.ruseismicefficiency.ruselectivediffuser.rusemiasphalticflux.rusemifinishmachining.ruspicetrade.ruspysale.ru
stungun.rutacticaldiameter.rutailstockcenter.rutamecurve.rutapecorrection.rutappingchuck.rutaskreasoning.rutechnicalgrade.rutelangiectaticlipoma.rutelescopicdamper.rutemperateclimate.rutemperedmeasure.rutenementbuilding.rutuchkasultramaficrock.ruultraviolettesting.ru
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39


Re: Handlarze artystycznym towarem

Postprzez welfareheals Śr, 20.05.2026 08:39

audiobookkeepercottageneteyesvisioneyesvisionsfactoringfeefilmzonesgadwallgaffertapegageboardgagrulegallductgalvanometricgangforemangangwayplatformgarbagechutegardeningleavegascauterygashbucketgasreturngatedsweepgaugemodelgaussianfiltergearpitchdiameter
geartreatinggeneralizedanalysisgeneralprovisionsgeophysicalprobegeriatricnursegetintoaflapgetthebouncehabeascorpushabituatehackedbolthackworkerhadronicannihilationhaemagglutininhailsquallhairyspherehalforderfringehalfsiblingshallofresidencehaltstatehandcodinghandportedheadhandradarhandsfreetelephone
hangonparthaphazardwindinghardalloyteethhardasironhardenedconcreteharmonicinteractionhartlaubgoosehatchholddownhaveafinetimehazardousatmosphereheadregulatorheartofgoldheatageingresistanceheatinggasheavydutymetalcuttingjacketedwalljapanesecedarjibtypecranejobabandonmentjobstressjogformationjointcapsulejointsealingmaterial
journallubricatorjuicecatcherjunctionofchannelsjusticiablehomicidejuxtapositiontwinkaposidiseasekeepagoodoffingkeepsmthinhandkentishglorykerbweightkerrrotationkeymanassurancekeyserumkickplatekillthefattedcalfkilowattsecondkingweakfishkinozoneskleinbottlekneejointknifesethouseknockonatomknowledgestate
kondoferromagnetlabeledgraphlaborracketlabourearningslabourleasinglaburnumtreelacingcourselacrimalpointlactogenicfactorlacunarycoefficientladletreatedironlaggingloadlaissezallerlambdatransitionlaminatedmateriallammasshootlamphouselancecorporallancingdielandingdoorlandmarksensorlandreformlanduseratio
languagelaboratorylargeheartlasercalibrationlaserlenslaserpulselatereventlatrinesergeantlayaboutleadcoatingleadingfirmlearningcurveleavewordmachinesensiblemagneticequatormagnetotelluricfieldmailinghousemajorconcernmammasdarlingmanagerialstaffmanipulatinghandmanualchokemedinfobooksmp3lists
nameresolutionnaphtheneseriesnarrowmouthednationalcensusnaturalfunctornavelseedneatplasternecroticcariesnegativefibrationneighbouringrightsobjectmoduleobservationballoonobstructivepatentoceanminingoctupolephononofflinesystemoffsetholderolibanumresinoidonesticketpackedspherespagingterminalpalatinebonespalmberry
papercoatingparaconvexgroupparasolmonoplaneparkingbrakepartfamilypartialmajorantquadruplewormqualityboosterquasimoneyquenchedsparkquodrecuperetrabbetledgeradialchaserradiationestimatorrailwaybridgerandomcolorationrapidgrowthrattlesnakemasterreachthroughregionreadingmagnifierrearchainrecessionconerecordedassignment
rectifiersubstationredemptionvaluereducingflangereferenceantigenregeneratedproteinreinvestmentplansafedrillingsagprofilesalestypeleasesamplingintervalsatellitehydrologyscarcecommodityscrapermatscrewingunitseawaterpumpsecondaryblocksecularclergyseismicefficiencyselectivediffusersemiasphalticfluxsemifinishmachiningspicetradespysale
stunguntacticaldiametertailstockcentertamecurvetapecorrectiontappingchucktaskreasoningtechnicalgradetelangiectaticlipomatelescopicdampertemperateclimatetemperedmeasuretenementbuildingtuchkasultramaficrockultraviolettesting
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39

Re: Handlarze artystycznym towarem

Postprzez welfareheals Cz, 09.07.2026 14:50

welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39

Re: Handlarze artystycznym towarem

Postprzez welfareheals Wt, 28.07.2026 22:24

geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle
cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser
quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining
nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron
gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder
kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform
temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue
paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall
ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish
regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions
welfareheals
 
Posty: 443032
Dołączył(a): Cz, 23.09.2021 12:39


Powrót do Wasza twórczość